NixOS
Release 23.05 (“Stoat”, 2023.05/31) {#sec-release-23.05}
Release 23.05 (“Stoat”, 2023.05/31) {#sec-release-23.05}
The NixOS release team is happy to announce a new version of NixOS. The release is called NixOS 23.05 ("Stoat").
NixOS is a Linux distribution, whose set of packages can also be used on other Linux systems and macOS.
Support is planned until the end of December 2023, handing over to NixOS 23.11.
To upgrade to the latest release, follow the upgrade chapter.
Highlights {#sec-release-23.05-highlights}
In addition to numerous new and updated packages, this release has the following highlights:
The default Nix version was updated from 2.11 to 2.13. In particular, this includes a small language alteration in the way floats are represented in
builtins.toJSON. See the release notes for 2.12 and 2.13 for more information.The default Linux Kernel was updated from version 5.15 to 6.1, see Kernelnewbies for what has changed. All Kernels currently shown on kernel.org are available.
systemd has been updated from v252 to v253, see the release notes for more information on the changes.
- Updating with
nixos-rebuild bootand rebooting is recommended, since in some rare cases thenixos-rebuild switchinto the new generation on a live system might fail due to missing mount units.
- Updating with
glibc has been updated from version 2.35 to 2.37, see the release notes for what was changed.
libxcrypt, the library providing the
crypt(3)password hashing function, is now built without support for algorithms not flaggedstrong. This affects the availability of password hashing algorithms used for system login (login(1),passwd(1)), but also Apache2 Basic-Auth, Samba, OpenLDAP, Dovecot, and many other packages.NixOS now defaults to using nsncd, a non-caching reimplementation of nscd in Rust, as its NSS lookup dispatcher. This replaces the buggy and deprecated nscd implementation provided through glibc. When you find problems, you can switch back by disabling it:
{ services.nscd.enableNsncd = false; }The internal option
boot.bootspec.enableis now enabled by default because RFC 0125 was merged. This means you will have a bootspec document calledboot.jsongenerated for each system and specialisation in the top-level. This is useful to enable advanced boot use cases in NixOS, such as Secure Boot.Two changes to
nixos-rebuildare important to highlight as well.- Support for an extra
--specialisationoption was added that can be used to change specialisation forswitchandtestcommands. - The
--target-hostand--build-hostoptions no longer treat thelocalhostvalue specially – to build on resp. deploy to a local machine, omit the relevant flag.
- Support for an extra
Python implements PEP 668, providing better feedback to users that try to run
pip installfor system-wide or user home installations.Cinnamon has been updated to version 5.6, see the pull request for what was changed.
GNOME has been updated to version 44, see the the release notes for details.
KDE Plasma has been updated to version 5.27, see the release notes for what was changed.
openrawas updated to20230225. Due to large scope of the update, currently onlyopenraPackages.engines.releaseandopenraPackages.engines.latestpackages are available. If you want to use the old engine versions or mods, they were moved to theopenraPackages_2019namespace.
New Services {#sec-release-23.05-new-services}
Akkoma, an ActivityPub microblogging server. Available as services.akkoma.
alertmanager-irc-relay, a Prometheus Alertmanager IRC Relay. Available as services.prometheus.alertmanagerIrcRelay.
alice-lg, a looking-glass for BGP sessions. Available as services.alice-lg.
atuin, a sync server for shell history. Available as services.atuin.
authelia, an open-source authentication and authorization server. Available as services.authelia.
birdwatcher, a small HTTP server meant to provide an API defined by Barry O'Donovan's birds-eye to the BIRD internet routing daemon. Available as services.birdwatcher.
blesh, a line editor written in pure bash. Available as programs.bash.blesh.
Budgie Desktop, a familiar, modern desktop environment. Available as
services.xserver.desktopManager.budgie.clash-verge, a Clash GUI based on tauri. Available as programs.clash-verge.
Cloudlog, a web-based Amateur Radio logging application. Available as services.cloudlog.
consul-template, a template renderer, notifier, and supervisor for HashiCorp Consul and Vault data. Available as services.consul-template.
cups-pdf-to-pdf, a PDF-generating CUPS backend based on cups-pdf. Available as services.printing.cups-pdf.
Deepin Desktop Environment, an elegant, easy to use and reliable desktop environment. Available as services.xserver.desktopManager.deepin.
esphome, a dashboard to configure ESP8266/ESP32 devices for use with Home Automation systems. Available as services.esphome.
frigate, an open source NVR built around real-time AI object detection. Available as services.frigate.
fzf, a command line fuzzyfinder. Available as programs.fzf.
gemstash, a RubyGems.org cache and private gem server. Available as services.gemstash.
gitea-actions-runner, a CI runner for Gitea/Forgejo Actions. Available as services.gitea-actions-runner.
evdevremapkeys, a daemon to remap key events. Available as services.evdevremapkeys.
gmediarender, a simple, headless UPnP/DLNA renderer. Available as services.gmediarender.
go2rtc, a camera streaming application with support for RTSP, WebRTC, HomeKit, FFMPEG, RTMP and other protocols. Available as services.go2rtc.
goeland, an alternative to rss2email written in Golang with many filters. Available as services.goeland.
gonic, a Subsonic music streaming server. Available as services.gonic.
hardware.ipu6, drivers for IPU6 based webcams on Intel Tiger Lake and Alder Lake.
harmonia, a Nix binary cache implemented in Rust using libnixstore. Available as services.harmonia.
hyprland, a dynamic tiling Wayland compositor that doesn't sacrifice on its looks. Available as programs.hyprland.
imaginary, a microservice for high-level image processing that Nextcloud can use to generate previews. Available as services.imaginary.
ivpn, a secure, private VPN with fast WireGuard connections. Available as services.ivpn.
vmalert, an alerting engine for VictoriaMetrics. Available as services.vmalert.instances.
jellyseerr, a web-based requests manager for Jellyfin, forked from Overseerr. Available as
services.jellyseerr.kavita, a self-hosted digital library. Available as services.kavita.
keyd, a key remapping daemon for Linux. Available as services.keyd.
lldap, a lightweight authentication server that provides an opinionated, simplified LDAP interface for authentication. Available as services.lldap.
minipro, an open source program for controlling the MiniPRO TL866xx series of chip programmers. Available as programs.minipro.
mmsd, a lower level daemon that transmits and receives MMSes. Available as services.mmsd.
monica, an open source personal CRM. Available as services.monica.
networkd-dispatcher, a dispatcher service for systemd-networkd connection status changes. Available as services.networkd-dispatcher.
nimdow, a window manager written in Nim, inspired by dwm. Available as services.xserver.windowManager.nimdow.enable.
opensearch, a search server alternative to Elasticsearch. Available as services.opensearch.
openvscode-server, run VS Code on a remote machine with access through a modern web browser from any device, anywhere. Available as services.openvscode-server.
peroxide, a fork of the official ProtonMail bridge that aims to be similar to Hydroxide. Available as services.peroxide.
photoprism, a AI-powered photos app for the decentralized web. Available as services.photoprism.
Pixelfed, an Instagram-like ActivityPub server. Available as services.pixelfed.
PufferPanel, a game server management panel designed to be easy to use. Available as services.pufferpanel.
QDMR, a GUI application and command line tool for programming DMR radios programs.qdmr.
readarr, book manager and automation (Sonarr for ebooks). Available as services.readarr.
ReGreet, a clean and customizable greeter for greetd. Available as programs.regreet.
rshim, the user-space rshim driver for the BlueField SoC. Available as services.rshim.
SFTPGo, a fully featured and highly configurable SFTP server with optional HTTP/S, FTP/S and WebDAV support. Available as services.sftpgo.
sharing, a command-line tool to share directories and files from the CLI to iOS and Android devices without the need of an extra client app. Available as programs.sharing.
sniffnet, an application to monitor your network traffic. Available as programs.sniffnet.
stargazer, a fast and easy to use Gemini server. Available as services.stargazer.
stevenblack-blocklist, a unified hosts file with base extensions for blocking unwanted websites. Available as networking.stevenblack.
systemd-repart, grow and add partitions to a partition table. Available as systemd.repart and boot.initrd.systemd.repart
trippy, a network diagnostic tool. Available as programs.trippy.
tts, a battle-tested deep learning toolkit for Text-to-Speech. Multiple servers may be configured below services.tts.servers.
ulogd, a userspace logging daemon for netfilter/iptables related logging. Available as services.ulogd.
v2rayA, a Linux web GUI client of Project V which supports V2Ray, Xray, SS, SSR, Trojan and Pingtunnel. Available as services.v2raya.
v4l2-relayd, a streaming relay for v4l2loopback using gstreamer. Available as services.v4l2-relayd.
vault-agent, a template renderer and API auth proxy for HashiCorp Vault, similar to
consul-template. Available as services.vault-agent.webhook, a lightweight webhook server. Available as services.webhook.
wgautomesh, a simple utility to help connect wireguard nodes together in a full mesh topology. Available as services.wgautomesh.
woodpecker, a simple CI engine with great extensibility. Available as services.woodpecker-server and services.woodpecker-agents.
wstunnel, a proxy tunnelling arbitrary TCP or UDP traffic through a WebSocket connection. Available as services.wstunnel.
Backward Incompatibilities {#sec-release-23.05-incompatibilities}
services.asusdconfiguration now uses strings instead of structured configuration, as upstream switched to the RON configuration format. Support for structured configuration may return when RON generation is implemented in nixpkgs.borgbackupmodule now has an option for inhibiting system sleep while backups are running, defaulting to off (not inhibiting sleep), available asservices.borgbackup.jobs.<name>.inhibitsSleep.The
opensshclient now comes with the~Cescape sequence disabled by default. It can be re-enabled by settingEnableEscapeCommandline yesThe
programs.sshclient module does not read/etc/ssh/ssh_known_hosts2anymore, since this location is deprecated since 2001.The
services.opensshserver module does not read~/.ssh/authorized_keys2anymore, since this location is deprecated since 2001.MAC-then-encrypt algorithms were removed from the default selection of
services.openssh.settings.Macs. If you still require these MACs, for example when you are relying on libssh2 (e.g. VLC) or the SSH library shipped on the iPhone, you can re-add them like this:{ services.openssh.settings.Macs = [ "hmac-sha2-512" "hmac-sha2-256" "umac-128@openssh.com" ]; }podmannow uses thenetavarknetwork stack. Users will need to delete all of their local containers, images, volumes, etc, by runningpodman system reset --forceonce before upgrading their systems.git-bughas been updated to at least version 0.8.0, which includes backwards incompatible changes. Thegit-bug-migrationpackage can be used to upgrade existing repositories.grayloghas been updated to version 5, which can not be updated directly from the previously packaged version 3.3. If you had installed the previously packaged version 3.3, please follow the upgrade path from 3.3 to 4.0 to 4.3 to 5.0.buildFHSUserEnvis now calledbuildFHSEnvand uses FlatPak's Bubblewrap sandboxing tool rather than Nixpkgs' own chrootenv. The old chrootenv-based implementation is still available viabuildFHSEnvChrootbut is considered deprecated and will be removed when the remaining uses inside Nixpkgs have been migrated. If your FHSEnv-wrapped application misbehaves when using the new bubblewrap implementation, please create an issue in Nixpkgs.nushellhas been updated to at least version 0.77.0, which includes potential breaking changes in aliases. The old aliases are now available asold-aliasbut it is recommended you migrate to the new format. See Reworked aliases.gajimhas been updated to version 1.7.3 which has disabled legacy ciphers. See changelog for version 1.7.0.keepassxandkeepassx2have been removed, due to upstream stopping development. Consider KeePassXC as a maintained alternative.The services.kubo.settings option is now no longer stateful. If you changed any of the options in services.kubo.settings in the past and then removed them from your NixOS configuration again, those changes are still in your Kubo configuration file but will now be reset to the default. If you're unsure, you may want to make a backup of your configuration file (probably
/var/lib/ipfs/config) and compare after the update.The Kubo HTTP API will no longer listen on localhost and will instead only listen on a Unix domain socket by default. Read the services.kubo.settings.Addresses.API option description for more information.
The EC2 image module no longer fetches instance metadata in stage-1. This results in a significantly smaller initramfs, since network drivers no longer need to be included, and faster boots, since metadata fetching can happen in parallel with startup of other services. This breaks services which rely on metadata being present by the time stage-2 is entered. Anything which reads EC2 metadata from
/etc/ec2-metadatashould now have anafterdependency onfetch-ec2-metadata.serviceThe mailman service now defaults to using a randomly generated REST API password instead of a hard-coded one.
minioremoved support for its legacy filesystem backend in RELEASE.2022-10-29T06-21-33Z. This means if your storage was created with the old format, minio will no longer start. Unfortunately, minio doesn't provide an automatic migration, they only provide instructions how to manually convert the node. To facilitate this migration, we keep around the last version that still supports the old filesystem backend asminio_legacy_fs. Use it viaservices.minio.package = minio_legacy_fs;to export your data before switching to the new version. See the corresponding issue for more details.services.sourcehut.dispatchand the corresponding package (sourcehut.dispatchsrht) have been removed due to upstream deprecation.The attributes used by
services.snapper.configs.<name>have changed. Migrate from this:{ services.snapper.configs.example = { subvolume = "/example"; extraConfig = '' ALLOW_USERS="alice" ''; }; }to this:
{ services.snapper.configs.example = { SUBVOLUME = "/example"; ALLOW_USERS = [ "alice" ]; }; }The default module options for services.snapserver.openFirewall, services.tmate-ssh-server.openFirewall and
services.unifi-video.openFirewallhave been changed fromtruetofalse. You will need to explicitly set this option totrue, or configure your firewall.The option
i18n.inputMethod.fcitx5.enableRimeDatahas been removed. Default RIME data is now included infcitx5-rimeby default, and can be customized usingfcitx5-rime.override { rimeDataPkgs = [ pkgs.rime-data # ... ]; }The
udevhwdb.bin file is now built with systemd-hwdb rather than the deprecated "udevadm hwdb". This may impact mappings where the same key is defined in multiple matching entries. The updated behavior will select the latest definition in case of conflict. In general, this should be a positive change, as the hwdb source files are designed with this ordering in mind. As an example, the mapping of the HP Dev One keyboard scan code for "mute mic" is corrected by this update. This change may impact users who have worked-around previously incorrect mappings.Kime has been updated from 2.5.6 to 3.0.2 and the
i18n.inputMethod.kime.configoption has been removed. Users should usedaemonModules,iconColor, andextraConfigoptions underi18n.inputMethod.kimeinstead.tuthas been updated from 1.0.34 to 2.0.0, and now uses the TOML format for the configuration file instead of INI. Additional information can be found here.i3status-rusthas been updated from 0.22.0 to 0.30.5, and this brings many changes to its configuration format. Additional information can be found here.The
wordpressderivation no longer contains any built-in plugins or themes. If you need them, you have to add them back to prevent your site from breaking. You can find them inwordpressPackages.{plugins,themes}.llvmPackages_rocm.llvmwill not containclangorcompiler-rt.llvmPackages_rocm.clangwill not containllvm.llvmPackages_rocm.clangNoCompilerRthas been removed in favor of usingllvmPackages_rocm.clang-unwrapped.services.xserver.desktopManager.plasma5.excludePackageshas been moved toenvironment.plasma5.excludePackages, for consistency with other Desktop Environments.teleporthas been updated from major version 10 to major version 12. Please see upstream upgrade instructions and release notes for versions 11 and 12. Note that Teleport does not officially support upgrades across more than one major version at a time. If you're running Teleport server components, it is recommended to first upgrade to an intermediate 11.x version by settingservices.teleport.package = pkgs.teleport_11. Afterwards, this option can be removed to upgrade to the default version (12).The EC2 image module previously detected and automatically mounted ext3-formatted instance store devices and partitions in stage-1 (initramfs), storing
/tmpon the first discovered device. This behaviour, which only catered to very specific use cases and could not be disabled, has been removed. Users relying on this should provide their own implementation, and probably use ext4 and perform the mount in stage-2.The EC2 image module previously detected and activated swap-formatted instance store devices and partitions in stage-1 (initramfs). This behaviour has been removed. Users relying on this should provide their own implementation.
gitlabhas been upgraded from major version 15 to major version 16 and requires at least PostgreSQL 13.6. Check the upgrade guide in the NixOS manual on how to upgrade your PostgreSQL installation.gitlab16 deprecates the use of external container registries, in our casepkgs.docker-distribution. Module users who haveservices.gitlab.registry.enableset totrueare advised to back up their state and switch to gitlab's fork by settingservices.gitlab.registry.packagetopkgs.gitlab-container-registry.fail2banhas been updated to 1.0.2, which has a few breaking changes compared to 0.11.2 (changelog for 1.0.1, changelog for 1.0.2)alberthas been updated from 0.17.6 to 0.20.13, and 0.18.0 changed the config format and many plugins (changelog for 0.18.0)dokuwikihas been updated from 2023-07-31a (Igor) to 2023-04-04 (Jack Jackrum), which has completely removed the options to embed HTML and PHP for security reasons. The htmlok plugin can be used to regain this functionality.The old unsupported version 6.x of the ELK-stack and Elastic beats have been removed. Use OpenSearch instead.
The
cosmocpackage has been removed. The upstream scripts incosmoccshould be used instead.Qt 5.12 and 5.14 have been removed, as the corresponding branches have been EOL upstream for a long time. This affected under 10 packages in nixpkgs, largely unmaintained upstream as well, however, out-of-tree package expressions may need to be updated manually.
The services.wordpress.sites.<name>.plugins and services.wordpress.sites.<name>.themes options have been converted from sets to attribute sets to allow for consumers to specify explicit install paths via attribute name.
protonmail-bridgepackage has been updated to major version 3.Nebula now runs as a system user and group created for each nebula network, using the
CAP_NET_ADMINambient capability on launch rather than starting as root. Ensure that any files each Nebula instance needs to access are owned by the correct user and group, by defaultnebula-${networkName}.The
i18n.inputMethod.fcitxoption has been replaced withi18n.inputMethod.fcitx5because fcitx 4pkgs.fcitxhas been removed.In
mastodonit is now necessary to specify location of file withPostgreSQLdatabase password. Inservices.mastodon.database.passwordFileparameter default value/var/lib/mastodon/secrets/db-passwordhas been changed tonull.The
nix.readOnlyStoreoption has been renamed toboot.readOnlyNixStoreto clarify that it configures the NixOS boot process, not the Nix daemon.The latest available version of Nextcloud is v26 (available as
pkgs.nextcloud26) which uses PHP 8.2 as interpreter by default. The installation logic is as follows:- If
system.stateVersionis >=23.05,pkgs.nextcloud26will be installed by default. - If
system.stateVersionis >=22.11,pkgs.nextcloud25will be installed by default. - Please note that an upgrade from v24 (or older) to v26 directly is not possible. Please upgrade to
nextcloud25(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud25;. - It's recommended to use the latest version available (i.e. v26) and to specify that using
services.nextcloud.package.
- If
.NET 5.0 and .NET 3.1 were removed due to being end-of-life, use a newer, supported .NET version. Visit the Support Policy for more information.
The iputils package, which is installed by default, no longer provides the
ninfod,rarpdandrdisctools. See upstream's release notes for more details and available replacements.The ppp plugin
rp-pppoe.sohas been renamed topppoe.soin ppp 2.4.9. Starting from ppp 2.5.0, there is no longer an alias for backwards compatibility. Configurations that use this plugin must be updated accordingly fromplugin rp-pppoe.sotoplugin pppoe.so. See upstream change.services.xserver.videoDrivers now defaults to the
modesettingdriver over device-specific ones. Theradeon,amdgpuandnouveaudrivers are still available, but effectively unmaintained and not recommended for use. Note that this does not affect your regular graphics drivers; this only concerns the DDX component of the driver, which most people are not relying on.services.xserver.libinput.enable is now set by default, enabling the more actively maintained and consistently behaved input device driver.
To enable the HTTP3 (QUIC) protocol for a nginx virtual host, set the
quicattribute on it to true, e.g.services.nginx.virtualHosts.<name>.quic = true;.In
services.fail2ban,bantime-increment.<name>options now default tonull(exceptbantime-increment.enable) and are used to set the corresponding option injail.localonly if notnull. Also, enforce thatbantime-increment.formulaandbantime-increment.multipliersare not both specified.The default
asteriskpackage was changed to v20 from v19. Asterisk versions 16 and 19 have been dropped due to being EOL. You may need to update /var/lib/asterisk to match the template files in${asterisk-20}/var/lib/asterisk.conntrack helper autodetection has been removed from kernels 6.0 and up upstream, and an assertion was added to ensure things don't silently stop working. Migrate your configuration to assign helpers explicitly or use an older LTS kernel branch as a temporary workaround.
The
services.pipewire.configoptions have been removed, as they have basically never worked correctly. All behavior defined by the default configuration can be overridden with drop-in files as necessary - see below for details.The catch-all
hardware.video.hidpi.enableoption was removed. Users on high density displays may want to:- Set
services.xserver.upscaleDefaultCursorto upscale the default X11 cursor for higher resolutions - Adjust settings under
fonts.fontconfigaccording to preference - Adjust
console.fontaccording to preference, though the kernel will generally choose a reasonably sized font
- Set
services.pipewire.media-sessionand thepipewire-media-sessionpackage have been removed, as they are no longer supported upstream. Users are encouraged to useservices.pipewire.wireplumberinstead.The
bagetpackage and module was removed due to being unmaintained.The
qlandkartegtandgarmindevpackages were removed due to being unmaintained and insecure.The
go-ethereumpackage has been updated to v1.11.5 and thepuppethcommand is no longer available as of v1.11.0.The
pnpmpackage has be updated to from version 7.29.1 to version 8.1.1 and Node.js 14 support has been discontinued (though, there are workarounds if Node.js 14 is still required)The
zplugpackage changes its output path from$outto$out/share/zplug. Users should update their dependency on${pkgs.zplug}/init.zshto${pkgs.zplug}/share/zplug/init.zsh.The
pict-rspackage was updated from an 0.3 alpha release to 0.3 stable, and related environment variables now require two underscores instead of one.The
shattered-pixel-dungeongame was updated from 1.1.2 to 2.0.2.- The location of game data has changed. To migrate it, run
mv ~/.shatteredpixel ~/.local/share/.shatteredpixel - The update will delete all your in-progress games.
- The location of game data has changed. To migrate it, run
espansohas been updated to major version 2. Therefore, migration steps may need to be performed. See the official migration instructions for how to perform these migrations. Further,espanso-waylandcan now be used for Wayland support.Only
k3sversion 1.26 is included. Users of thek3s_1_24ork3s_1_25packages should upgrade to use the1.26version of the package.The
nerdfontspackage has been updated to major version 3, which includes potential breaking changes.
Other Notable Changes {#sec-release-23.05-notable-changes}
To follow RFC 0042 a few options of
opensshhave been moved fromextraConfigto the new freeform optionsettingsand renamed, e.g.:services.openssh.forwardX11toservices.openssh.settings.X11Forwardingservices.openssh.kbdInteractiveAuthentication->services.openssh.settings.KbdInteractiveAuthenticationservices.openssh.passwordAuthenticationtoservices.openssh.settings.PasswordAuthenticationservices.openssh.useDnstoservices.openssh.settings.UseDnsservices.openssh.permitRootLogintoservices.openssh.settings.PermitRootLoginservices.openssh.logLeveltoservices.openssh.settings.LogLevelservices.openssh.kexAlgorithmstoservices.openssh.settings.KexAlgorithmsservices.openssh.macstoservices.openssh.settings.Macsservices.openssh.cipherstoservices.openssh.settings.Ciphersservices.openssh.gatewayPortstoservices.openssh.settings.GatewayPorts
vim_configurablehas been renamed tovim-fullto avoid confusion:vim-full's build-time features are configurable, but bothvimandvim-fullare customizable (in the sense of user configuration, like vimrc).Pantheon now defaults to Mutter 43 and GNOME settings daemon 43, all Pantheon packages are now tracking elementary OS 7 updates.
The module for the application firewall
opensnitchgot the ability to configure rules. Available as services.opensnitch.rulesThe module
usbmuxdnow has the ability to change the package used by the daemon. In case you're experiencing issues withusbmuxdyou can try an alternative program likeusbmuxd2. Available as services.usbmuxd.packagenetboxwas updated to 3.5. NixOS'services.netbox.packagestill defaults to 3.3 ifstateVersionis earlier than 23.05. Please review upstream's breaking changes for 3.4.0 and for 3.5.0, and upgrade NetBox by changingservices.netbox.package. Database migrations will be run automatically.services.netboxnow support RFC42-style options, throughservices.netbox.settings.services.mastodongained a tootctl wrapped namedmastodon-tootctlsimilar tonextcloud-occwhich can be executed from any user and switches to the configured mastodon user with sudo and sources the environment variables.services.borgmaticnow allows for multiple configurations, placed in/etc/borgmatic.d/, you can define them withservices.borgmatic.configurations.service.openafsServerfeatures a new backup serverpkgs.fabsas a replacement for openafs's ownbuserver. See FABS to check if this is an viable replacement. It stores backups as volume dump files and thus better integrates into contemporary backup solutions.services.maddygot several updates:- Configuration of users and their credentials using
services.maddy.ensureCredentials. - TLS configuration is now possible via
services.maddy.tlswith two loaders present: ACME and file based.
- Configuration of users and their credentials using
The
dnsmasqservice now takes configuration via theservices.dnsmasq.settingsattribute set. The optionservices.dnsmasq.extraConfigwill be deprecated when NixOS 22.11 reaches end of life.The
dokuwikiservice is now configured viaservices.dokuwiki.sites.<name>.settingsattribute set;extraConfighas been removed. The{aclUse,superUser,disableActions}attributes have been renamed accordingly.pluginsConfignow only accepts an attribute set of booleans. Passing plain PHP is no longer possible. Same applies toaclwhich now also only accepts structuredsettings.The
zshpackage changes the way to set environment variables on NixOS systems whereprograms.zsh.enableequalsfalse. It now sources/etc/set-environmentwhen reading the system-levelzshenvfile. Before, it sourced/etc/profilewhen reading the system-levelzprofilefile.The
wordpressservice now takes configuration via theservices.wordpress.sites.<name>.settingsattribute set,extraConfigis still available to append additional text towp-config.php.To reduce closure size in
nixos/modules/profiles/minimal.nixprofile disabled installation documentations and manuals. Also disabledlogrotateandudisks2services.To reduce closure size in
nixos/modules/installer/netboot/netboot-minimal.nixprofile disabled load linux firmwares, pre-installing the complete stdenv andnetworking.wirelessservice.The minimal ISO image now uses the
nixos/modules/profiles/minimal.nixprofile.NixOS installer ISOs can now be built for
powerpc64le-linux; seenixos/modules/installer/sd-card/sd-image-powerpc64le.nixand PR 192672. Hydra does not support this platform, so you must build the binaries yourself.The
ghcWithPackagesandghcWithHooglewrappers will now also symlink GHC's and all included libraries' documentation to$out/share/docfor convenience. If undesired, the old behavior can be restored by overriding the builders with{ installDocumentation = false; }.The nftables module now validates its ruleset at build time. The new
networking.nftables.checkRulesetoption allows disabling this check, which may fail when rules have very specific requirements, that the sandbox environment, by default, will not cover. Thenetworking.nftables.preCheckRulesetoption can be used to prepare the environment before the checks are run.The
services.mastodonmodule now supports connection to a remotePostgreSQLdatabase.services.nextcloud.database.createLocallynow uses socket authentication and is no longer compatible with password authentication.- If you want the module to manage the database for you, unset
services.nextcloud.config.dbpassFile(andservices.nextcloud.config.dbhost, if it's set). - If you want to use password authentication and create the database locally, you will have to use
services.mysqlto set it up.
- If you want the module to manage the database for you, unset
services.nextcloud.config.objectstore.s3.sseCKeyFileis a new option to enable server-side encryption with customer provided keys (SSE-C) for your S3 in Nextcloud.NixOS swap partitions with random encryption can now control the sector size, cipher, and key size used to set up the plain encryption device over the underlying block device rather than allowing them to be determined by
cryptsetup(8). One can use these features like so:{ swapDevices = [ { device = "/dev/disk/by-partlabel/swapspace"; randomEncryption = { enable = true; cipher = "aes-xts-plain64"; keySize = 512; sectorSize = 4096; }; } ]; }New option
security.pam.zfsto enable unlocking and mounting of encrypted ZFS home dataset at login.services.peertubenow requires you to specify the secret filesecrets.secretsFile. It can be generated by runningopenssl rand -hex 32. Before upgrading, check the release notes for PeerTube v5.0.0.And backup your data.services.chronydis now started with additional systemd sandbox/hardening options for better security.PostgreSQL has added opt-in support for JIT compilation. It can be enabled like this:
{ services.postgresql.enableJIT = true; }services.netdataoffers aservices.netdata.deadlineBeforeStopSecoption which will control the deadline (in seconds) after which systemd will consider your netdata instance as dead if it didn't start in the elapsed time. It is helpful when your netdata instance takes longer to start because of a large amount of state or upgrades.services.dhcpcdservice stopped soliciting or accepting IPv6 Router Advertisements on interfaces that use static IPv6 addresses. If your network provides both IPv6 unique local addresses (ULA) and globally unique addresses (GUA) through autoconfiguration with SLAAC, you must add the parameternetworking.dhcpcd.IPv6rs = true;.The module
services.headscalewas refactored to be compliant with RFC 0042. To be precise, this means that the following things have changed:- Most settings have been migrated below services.headscale.settings which is a freeform attribute-set that will be converted into headscale's YAML config format. This means that the configuration from headscale's example configuration can be directly written as attribute-set in Nix within this option.
services.kubonow unmountsipfsMountDirandipnsMountDireven if it is killed unexpectedly whenautoMountis enabled.services.grafanalistens only on localhost by default again. This was changed to the upstream default of0.0.0.0by accident in the freeform setting conversion.Grafana Tempo has been updated to version 2.0. See the upstream upgrade guide for migration instructions.
A new
virtualisation.rosettamodule was added to allow runningx86_64binaries through Rosetta inside virtualised NixOS guests on Apple Silicon. This feature works by default with the UTM virtualisation package.The new option
users.motdFileallows configuring a Message Of The Day that can be updated dynamically.The
rootpackage is now built with the"-Dgnuinstall=ON"CMake flag, making the output conform thebinlibsharelayout. In this layout,tutorialsis undershare/doc/ROOT/;cmake,font,icons,jsandmacroundershare/root;Makefile.compandMakefile.configunderetc/root.There are various new options in the
services.nginxmodule:- Enabling global redirect in
services.nginx.virtualHostsnow allows one to add exceptions with thelocationsoption. - The
proxyCachePathoption has been added toservices.nginx. It allows configuring theproxy_cache_path, that configures the storage path and various other settings for the cache. - A new option
recommendedBrotliSettingshas been added toservices.nginx. Learn more about compression in Brotli format here. services.nginx.recommendedProxySettingsnow removes theConnectionheader preventing clients from closing backend connections.
- Enabling global redirect in
The nginx module also received an update to
services.nginx.recommendedGzipSettings:- Enables gzip compression for only certain proxied requests.
- Allow checking and loading of precompressed files.
- Updated gzip mime-types.
- Increased the minimum length of a response that will be gzipped.
Garage version is based on system.stateVersion, existing installations will keep using version 0.7. New installations will use version 0.8. In order to upgrade a Garage cluster, please follow upstream instructions and configure services.garage.package.
Nebula now supports the
services.nebula.networks.<name>.isRelayandservices.nebula.networks.<name>.relaysconfiguration options for setting up or allowing traffic relaying. See the announcement for more details about relays.Resilio sync secret keys can now be provided using a secrets file at runtime, preventing these secrets from ending up in the Nix store.
The
firewallandnatmodules can now optionally rely on an nftables based implementation. Enablenetworking.nftablesto use it.The
services.fwupdmodule now allows arbitrary daemon settings to be configured in a structured manner (services.fwupd.daemonSettings).services.xserver.desktopManager.plasma5.phononBackendnow defaults to vlc according to upstrean recommendationThe
zramSwapis now implemented withzram-generator, and the optionzramSwap.numDevicesfor using ZRAM devices as general purpose ephemeral block devices has been removed.As Singularity has renamed to Apptainer to distinguish from an un-renamed fork by Sylabs Inc., there are now two packages of Singularity/Apptainer:
apptainer: Fromgithub.com/apptainer/apptainer, which is the new repo after renaming.singularity: Fromgithub.com/sylabs/singularity, which is the fork by Sylabs Inc..
singularity-tools.buildImagegot a new input argumentsingularityto specify which package to use.The new option
programs.singularity.enableFakeroot, if set totrue, provides--fakerootsupport forapptainerandsingularity.The new option
services.tailscale.useRoutingFeaturescontrols various settings for using Tailscale features like exit nodes and subnet routers. If you wish to use your machine as an exit node, you can set this setting toserver, otherwise if you wish to use an exit node you can set this setting toclient. The strict RPF warning has been removed as the RPF will be loosened automatically based on the value of this setting.openjdkfrom version 11 and above is not build withopenjfx(i.e.: JavaFX) support by default anymore. You can re-enable it by overriding, e.g.:openjdk11.override { enableJavaFX = true; };.Xastir can now access AX.25 interfaces via the
libax25package.nixos-versionnow accepts--configuration-revisionto display more information about the current generation revisionThe option
services.nomad.extraSettingsPluginshas been fixed to allow more than one plugin in the path.The option
services.prometheus.exporters.pihole.intervaldoes not exist anymore and has been removed.The option
services.gpsd.devicehas been replaced withservices.gpsd.devices, which supports multiple devices.k3scan now be configured with anEnvironmentFilefor its systemd service, allowing secrets to be provided without ending up in the Nix Store.The
giteamodule options have been moved into a freeform attribute set belowservices.gitea.settings.boot.initrd.luks.device.<name>has a newtryEmptyPassphraseoption, this is useful for OEMs who need to install an encrypted disk with a future settable passphraseThe
bindmodule now allows the per-zoneallow-querysetting to be configured (previously it was hard-coded toany; it still defaults toanyto retain compatibility).The option
services.jitsi-videobridge.apishas been renamed tocolibriRestApiand turned into a boolean. Setting it totruewill enable the private rest API, useful for monitoring usingservices.prometheus.exporters.jitsi.enable. Learn more about the API: "The COLIBRI control interface (/colibri/)".Booting from a volume managed by the Stratis storage management daemon is now supported. Use
fileSystems.<name>.stratis.poolUuidto configure the pool containing the fs.
Nixpkgs internals {#sec-release-23.05-nixpkgs-internals}
buildDunePackagenow defaults tostrictDeps = truewhich means that any library should go intobuildInputsorcheckInputs. Any executable that is run on the building machine should go intonativeBuildInputsornativeCheckInputsrespectively. Example of executables areocaml,findlibandmenhir. PPXs are libraries which are built by dune and should therefore not go intonativeBuildInputs.buildFHSUserEnvis now calledbuildFHSEnvand uses FlatPak's Bubblewrap sandboxing tool rather than Nixpkgs' own chrootenv. The old chrootenv-based implementation is still available viabuildFHSEnvChrootbut is considered deprecated and will be removed when the remaining uses inside Nixpkgs have been migrated. If your FHSEnv-wrapped application misbehaves when using the new bubblewrap implementation, please create an issue in Nixpkgs.Top-level
buildPlatform,hostPlatform,targetPlatformhave been deprecated, usestdenv.Xinstead.carnixandcratesIOhas been removed due to being unmaintained, use alternatives such as naersk and crate2nix instead.checkInputshave been renamed tonativeCheckInputs, because they behave the same asnativeBuildInputswhendoCheckis set.checkInputsnow denote a new type of dependencies, added tobuildInputswhendoCheckis set. As a rule of thumb,nativeCheckInputsare tools on$PATHused during the tests, andcheckInputsare libraries which are linked to executables built as part of the tests. Similarly,installCheckInputsare renamed tonativeInstallCheckInputs, corresponding tonativeBuildInputs, andinstallCheckInputsare a new type of dependencies added tobuildInputswhendoInstallCheckis set. (Note that this change will not cause breakage to derivations withstrictDepsunset, which are most packages except python, rust, ocaml and go packages).DocBook option documentation, which has been deprecated since 22.11, will now cause a warning when documentation is built. Out-of-tree modules should migrate to using CommonMark documentation as outlined in to silence this warning.
DocBook option documentation support will be removed in the next release and CommonMark will become the default. DocBook option documentation that has not been migrated until then will no longer render properly or cause errors.
lib.systems.examples.ghcjsand consequentlypkgsCross.ghcjsnow use the target tripletjavascript-unknown-ghcjsinstead ofjs-unknown-ghcjs. This has been done to match an upstream decision to follow Cabal's platform naming more closely. Nixpkgs will also rejectjsas an architecture name.Lisp gained a manual section, documenting a new and backwards incompatible interface. The previous interface will be removed in a future release.
Calling
makeSetupHookwithout passing anameargument is deprecated.nixos/lib/make-disk-image.nixhandlescontentsarguments that are directories better, fixing a bug where it used to put them in a subdirectory of the intendedtarget.nixos/lib/make-disk-image.nixcan now mutate EFI variables, run user-provided EFI firmware or variable templates. This is now extensively documented in the NixOS manual.Nixpkgs now uses IEEE-standard floating point arithmetic on
powerpc64le-linux.Deprecated
xlibsWrappertransitional package has been removed in favour of direct use of its constituents:xorg.libX11,freetypeand others.
Detailed migration information {#sec-release-23.05-migration}
Pipewire configuration overrides {#sec-release-23.05-migration-pipewire}
Why this change? {#sec-release-23.05-migration-pipewire-why}
The Pipewire config semantics don't really match the NixOS module semantics, so it's extremely awkward to override the default config, especially when lists are involved. Vendoring the configuration files in nixpkgs also creates unnecessary maintenance overhead.
Also, upstream added a lot of accommodations to allow doing most of the things you'd want to do with a config edit in better ways.
Migrating your configuration {#sec-release-23.05-migration-pipewire-how}
Compare your settings to the defaults and where your configuration differs from them.
Then, create a drop-in JSON file in /etc/pipewire/<config file name>.d/99-custom.conf (the actual filename can be anything) and migrate your changes to it according to the following sections.
Repeat for every file you've modified, changing the directory name accordingly.
Things you can just copy over {#sec-release-23.05-migration-pipewire-simple}
If you are:
- setting properties via
*.properties - loading a new module to
context.modules - creating new objects with
context.objects - declaring SPA libraries with
context.spa-libs - running custom commands with
context.exec - adding new rules with
*.rules - running custom PulseAudio commands with
pulse.cmd
Move the definitions into the drop-in.
Note that the use of context.exec is not recommended and other methods of running your thing are likely a better option.
{
"context.properties": {
"your.property.name": "your.property.value"
},
"context.modules": [
{ "name": "libpipewire-module-my-cool-thing" }
],
"context.objects": [
{ "factory": { ... } }
],
"alsa.rules": [
{ "matches: { ... }, "actions": { ... } }
]
}
Removing a module from context.modules {#sec-release-23.05-migration-pipewire-removing-modules}
Look for an option to disable it via context.properties ("module.x11.bell": "false" is likely the most common use case here).
If one is not available, proceed to Nuclear option.
Modifying a module's parameters in context.modules {#sec-release-23.05-migration-pipewire-modifying-modules}
For most modules (e.g. libpipewire-module-rt) it's enough to load the module again with the new arguments, e.g.:
{
"context.modules": [
{
"name": "libpipewire-module-rt",
"args": {
"rt.prio": 90
}
}
]
}
Note that module-rt specifically will generally use the highest values available by default, so setting limits on the pipewire systemd service is preferable to reloading.
If reloading the module is not an option, proceed to Nuclear option.
Nuclear option {#sec-release-23.05-migration-pipewire-nuclear}
If all else fails, you can still manually copy the contents of the default configuration file
from ${pkgs.pipewire}/share/pipewire to /etc/pipewire and edit it to fully override the default.
However, this should be done only as a last resort. Please talk to the Pipewire maintainers if you ever need to do this.